Tested Applications
| Positive WB detected in | human heart tissue, human skeletal muscle tissue, pig kidney tissue, pig heart tissue, rabbit heart tissue, rabbit kidney tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue, mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66805-1-Ig targets AQP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.
| Tested Reactivity | human, mouse, pig, rabbit |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species |
| Full Name | aquaporin 1 (Colton blood group) |
| Calculated Molecular Weight | 269 aa, 29 kDa |
| Observed Molecular Weight | 28 kDa, 38-40 kDa |
| GenBank Accession Number | BC022486 |
| Gene Symbol | AQP1 |
| Gene ID (NCBI) | 358 |
| RRID | AB_2882148 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P29972 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 40-45 kDa. (1530176)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AQP1 antibody 66805-1-Ig | Download protocol |
| IHC protocol for AQP1 antibody 66805-1-Ig | Download protocol |
| WB protocol for AQP1 antibody 66805-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AQP1 Monoclonal antibody (2E5D6), catalog number 66805-1-Ig, has 9 citations published in journals including J Extracell Vesicles, Advanced Science, International Journal of Biological Macromolecules, Clinical and Translational Medicine, Cells, Journal of Cellular and Molecular Medicine, iScience, and STAR Protocols. Research fields span renal diseases (diabetic nephropathy, IgA nephropathy, lupus nephritis, acute kidney injury), vascular biology, blood-brain barrier integrity, lung adenocarcinoma, mitochondrial dysfunction, ciliopathy, and tissue imaging.
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles CKAP4 in Extracellular Vesicle-Derived From Podocyte Serves as a Non-Invasive Diagnostic Biomarker for Diabetic Nephropathy and Promotes Vascular Calcification. | ||
Adv Sci (Weinh) Behind the Indolent Facade: Uncovering the Molecular Features and Malignancy Potential in Lung Minimally Invasive Adenocarcinoma by Single-Cell Transcriptomics | ||
Adv Sci (Weinh) G6PC Downregulation Promotes Renal Calcium Oxalate Stone Formation via Lactate-Induced SNAIL1 K206 Lactylation and Epithelial-Mesenchymal Transition. | ||
Int J Biol Macromol Panax notoginseng saponins protect the blood-brain barrier against oxidative stress by activating the Akap12-PI3K/AKT-AQP1 signaling axis.
| ||
Clin Transl Med Single-cell RNA sequencing of pediatric renal tissues revealed the potential relationship between immunoglobulin A nephropathy and immunoglobulin A vasculitis with nephritis | ||
Cells The CDO1-ACSM3 Axis Mediates Renal Tubule Lipid Deposition and Injury by Causing Mitochondrial Dysfunction in Lupus Nephritis. |
