Aquaporin 4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82296-6-RR (same clone as 82296-6-PBS)

  37°C incubated mouse brain tissue were subjected to SDS PAGE followed by western blot with 82296-6-RR (Aquaporin 4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82296-6-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 82296-6-RR (same clone as 82296-6-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 82296-6-RR (Aquaporin 4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82296-6-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 82296-6-RR (same clone as 82296-6-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 82296-6-RR (Aquaporin 4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82296-6-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 82296-6-RR (same clone as 82296-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Aquaporin 4 antibody (82296-6-RR, Clone: 240856C7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82296-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82296-6-RR

  Biolayer interferometry (BLl) kinetic assays of 82296-6-RR against Human Aquaporin 4 were performed. The affinity constant is 5.06 nM.

Aquaporin 4 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 82296-6-PBS

Clone No.240856C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

AQP4, 240856C7, AQP 4, AQP-4, Aquaporin4

---

Product Information

82296-6-PBS targets Aquaporin 4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9561

  Product name: Recombinant human AQP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 208-323 aa of BC022286

  Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

• Full Name: Aquaporin 4
• Calculated Molecular Weight: 323 aa, 35 kDa
• Observed Molecular Weight: 32-34 kDa
• GenBank Accession Number: BC022286
• Gene Symbol: Aquaporin 4
• Gene ID (NCBI): 361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P55087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.