Home
Products
Primary Antibodies
AQP9 Polyclonal antibody, PBS Only (20380-1-PBS)

Filter: AllWBIHCIF-P

WB analysis using 20380-1-AP (same clone as 20380-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20380-1-AP (AQP9 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
WB analysis using 20380-1-AP (same clone as 20380-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20380-1-AP (AQP9 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
WB analysis using 20380-1-AP (same clone as 20380-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20380-1-AP (AQP9 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 20380-1-AP (same clone as 20380-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20380-1-AP (AQP9 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 20380-1-AP (same clone as 20380-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20380-1-AP (AQP9 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 20380-1-AP (same clone as 20380-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using AQP9 antibody (20380-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 20380-1-AP (same clone as 20380-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using AQP9 antibody (20380-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IF Staining of human liver using 20380-1-AP (same clone as 20380-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver tissue using AQP9 antibody (20380-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IF Staining of human liver using 20380-1-AP (same clone as 20380-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver tissue using AQP9 antibody (20380-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 20380-1-AP (same clone as 20380-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using AQP9 antibody (20380-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20380-1-PBS in a different storage buffer formulation.

AQP9 Polyclonal antibody, PBS Only

Name: AQP9 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20380-1-PBS

AQP9 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 20380-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

AQP 9, AQP-9, Aquaglyceroporin 9, Aquaglyceroporin-9, Aquaporin-9

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20380-1-PBS targets AQP9 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14200 Product name: Recombinant human AQP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 211-295 aa of BC026258 Sequence: SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKAEQSEDKPEKYELSVIM Predict reactive species
Full Name	aquaporin 9
Calculated Molecular Weight	295 aa, 31 kDa
Observed Molecular Weight	31 kDa
GenBank Accession Number	BC026258
Gene Symbol	AQP9
Gene ID (NCBI)	366
RRID	AB_2935448
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O43315
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Aquaporins (AQPs), also known as water channel proteins, are members of a large protein family that osmotically modulate water fluid homeostasis in several tissues. AQP9 (Aquaporin 9) is a member of the aquaporin family that acts as a water-selective membrane channel, and it may be involved in cell migration, angiogenesis, and tumor growth. AQP9 is involved in arsenic uptake in hepatocellular carcinoma cells, in which p38-MAPK may play a limited role. AQP9 was demonstrated to promote astrocytoma cell invasion and motility via the AKT pathway.