ARAP2 Polyclonal antibody

• 

  WB analysis of mouse brain using 25143-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25143-1-AP (ARAP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 25143-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25143-1-AP (ARAP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 25143-1-AP

  IP result of anti-ARAP2 (IP:25143-1-AP, 4ug; Detection:25143-1-AP 1:300) with mouse brain tissue lysate 4000ug.

ARAP2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25143-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

ARAP2, Centaurin delta 1, CENTD1, Cnt d1, KIAA0580, PARX, Protein PARX

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25143-1-AP targets ARAP2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18469

  Product name: Recombinant human ARAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1356-1704 aa of BC105089

  Sequence: LTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSQTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQILK

• Full Name: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
• Calculated Molecular Weight: 1704 aa, 193 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC105089
• Gene Symbol: ARAP2
• Gene ID (NCBI): 116984
• RRID: AB_2879922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WZ64
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.