ARD1A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86450-3-RR (same clone as 86450-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86450-3-RR (ARD1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86450-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86450-3-RR (same clone as 86450-3-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ARD1A antibody (86450-3-RR, Clone: 251237F2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86450-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86450-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86450-3-RR against Human ARD1A were performed. The affinity constant is 5.33 nM.

ARD1A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86450-3-PBS

Clone No.251237F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ARD1, EC:2.3.1.255, hARD1, NAA10, Naa10p

---

Product Information

86450-3-PBS targets ARD1A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6519

  Product name: Recombinant human ARD1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC000308

  Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

• Full Name: ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC000308
• Gene Symbol: ARD1A
• Gene ID (NCBI): 8260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41227
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.