ARF3 Recombinant monoclonal antibody, PBS Only

ARF3 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85995-1-PBS
Clone No.250462B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

ADP ribosylation factor 3, ADP-ribosylation factor 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85995-1-PBS targets ARF3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1174

Product name: Recombinant human ARF3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-181 aa of BC017565

Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Predict reactive species
Full Name ADP-ribosylation factor 3
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC017565
Gene Symbol ARF3
Gene ID (NCBI) 377
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61204
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20kda protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF3 is 95% homolouous to ARF1. Its function was not fully understood. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.

Loading...
||
New chat Able
正在加载,请稍候...