ARF6 Polyclonal antibody

ARF6 Polyclonal Antibody for IHC, ELISA
Cat No. 18119-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

ADP ribosylation factor 6, ARF6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

18119-1-AP targets ARF6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12642

Product name: Recombinant human ARF6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 37-152 aa of BC002952

Sequence: SVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQP

Predict reactive species
Full Name ADP-ribosylation factor 6
Calculated Molecular Weight 20 kDa
GenBank Accession NumberBC002952
Gene Symbol ARF6
Gene ID (NCBI) 382
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62330
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20kda protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF6 is one of best identified ARFs It is present at the plasma membrane and to some extent on endosomal membranes where it regulates the flow of trafficking into and out of the cell and the actin cytoskeleton. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.

Loading...
||
New chat Able
正在加载,请稍候...