KD/KO Validated

ARFGEF2 Polyclonal antibody

ARFGEF2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31277-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

BIG2, ARFGEP2, Brefeldin A inhibited GEP 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HepG2 using 31277-1-AP
WB result of ARFGEF2 antibody (31277-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARFGEF2 transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 31277-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 31277-1-AP (ARFGEF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human intrahepatic cholangiocarcinoma using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human intrahepatic cholangiocarcinoma using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 31277-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 31277-1-AP (ARFGEF2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARFGEF2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue
Positive IHC detected in	human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissue, mouse cerebellum tissue, mouse pancreas tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31277-1-AP targets ARFGEF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag35396 Product name: Recombinant human ARFGEF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 211-370 aa of BC050449 Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL Predict reactive species
Full Name	ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
Observed Molecular Weight	202 kDa
GenBank Accession Number	BC050449
Gene Symbol	ARFGEF2
Gene ID (NCBI)	10564
RRID	AB_3669925
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y6D5
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.

Protocols

Product Specific Protocols
IHC protocol for ARFGEF2 antibody 31277-1-AP	Download protocol
WB protocol for ARFGEF2 antibody 31277-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ARFGEF2 Polyclonal antibody (Cat# 31277-1-AP) has 1 total citation. The cited publication appeared in CNS Neurosci Ther (Impact Factor 6.6), published in 2025. The research field is Alzheimer's disease, specifically examining APOE4-induced pathological and molecular features at the presymptomatic stage in mice using Western blot.

Species	Application	Title
mouse	WB	CNS Neurosci Ther Sequential Proteomic Analysis Reveals the Key APOE4-Induced Pathological and Molecular Features at the Presymptomatic Stage in Alzheimer's Disease Mice Authors - Pengju Wei View Article