ARFRP1 Polyclonal antibody

ARFRP1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17712-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

ARP1, ARF-related protein 1, ARF related protein 1, ADP-ribosylation factor-related protein 1, ADP ribosylation factor related protein 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

17712-1-AP targets ARFRP1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12036

Product name: Recombinant human ARFRP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC092480

Sequence: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT

Predict reactive species
Full Name ADP-ribosylation factor related protein 1
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 22-25 kDa
GenBank Accession NumberBC092480
Gene Symbol ARFRP1
Gene ID (NCBI) 10139
RRIDAB_2289839
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13795
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARFRP1, or ADP-ribosylation factor-related protein 1, is a small GTPase that is significantly similar to the ARF family of proteins. It plays a crucial role in intracellular membrane trafficking, particularly in post-Golgi membrane trafficking processes. ARFRP1 is primarily associated with the trans-Golgi compartment and the trans-Golgi network (TGN), where it functions as an essential regulatory factor for the targeting of Arl1 and GRIP domain-containing proteins, such as golgin-97 and golgin-245, onto Golgi membranes. Furthermore, ARFRP1 works in concert with Arl1 and GRIP proteins to facilitate the transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, as well as the retrograde transport of TGN38 and Shiga toxin from endosomes back to the TGN. This protein is also known to function upstream of ARL1 and ARL5, coordinating the recruitment of distinct tethering factors, golgins, and GARP, to the TGN. This mechanism is essential for the delivery of retrograde cargos to the TGN, making ARFRP1 a master regulator of retrograde-carrier tethering to the TGN.

Protocols

Product Specific Protocols
WB protocol for ARFRP1 antibody 17712-1-APDownload protocol
IHC protocol for ARFRP1 antibody 17712-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Anal Chem

Targeted Proteomic Analysis of Small GTPases in Radioresistant Breast Cancer Cells

Authors - Zi Gao
Loading...
||
New chat Able
正在加载,请稍候...