ARHGAP25 Polyclonal antibody

• 

  WB analysis using 14349-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14349-1-AP (ARHGAP25 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14349-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14349-1-AP (ARHGAP25 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14349-1-AP

  WB result of ARHGAP25 antibody (14349-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARHGAP25 transfected Jurkat cells.

• 

  IP experiment of Jurkat using 14349-1-AP

  IP result of anti-ARHGAP25 (IP:14349-1-AP, 4ug; Detection:14349-1-AP 1:500) with Jurkat cells lysate 1000ug.

• 

  IHC staining of human tonsillitis using 14349-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14349-1-AP (ARHGAP25 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human tonsillitis using 14349-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14349-1-AP (ARHGAP25 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 14349-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14349-1-AP (ARHGAP25 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 14349-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using ARHGAP25 antibody (14349-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

ARHGAP25 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14349-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KIAA0053, Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25

---

Tested Applications

• Positive WB detected in: Jurkat cells, Ramos cells, THP-1 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

14349-1-AP targets ARHGAP25 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5691

  Product name: Recombinant human ARHGAP25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-347 aa of BC039591

  Sequence: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLF

• Full Name: Rho GTPase activating protein 25
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC039591
• Gene Symbol: ARHGAP25
• Gene ID (NCBI): 9938
• RRID: AB_2059273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42331
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARHGAP25 (Rho GTPase-activating protein 25) also known as KAIA0053, belongs to a family of Rho GTPase-modulating proteins which are implicated in actin remodeling,cell polarity, and cell migration. ARHGAP25 has a key role in the pathomechanism of autoantibody-induced arthritis in which it regulates inflammation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Carcinogenesis; ARHGAP25 suppresses the development of breast cancer by an ARHGAP25/Wnt/ASCL2 feedback loop; Authors - Sijia Han ; KD Validated