GRAF Recombinant monoclonal antibody, PBS Only (Detector)

GRAF Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83206-1-PBS
Clone No.240086A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

ARHGAP26, 240086A11, GRAF1, KIAA0621, Oligophrenin 1 like protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83206-1-PBS targets GRAF as part of a matched antibody pair:

MP00157-1: 83206-2-PBS capture and 83206-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12008

Product name: Recombinant human ARHGAP26 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 403-759 aa of BC068555

Sequence: RGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL

Predict reactive species
Full Name Rho GTPase activating protein 26
Calculated Molecular Weight 759 aa, 86 kDa
Observed Molecular Weight 92-100 kDa
GenBank Accession NumberBC068555
Gene Symbol ARHGAP26
Gene ID (NCBI) 23092
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UNA1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GTPase Regulator Associated with Focal Adhesion Kinase (GRAF), also known as Rho GTPase activating protein 26 (ARHGAP26) , is a GTPase-activating protein and inhibits the activity of Rho GTPases by promoting the hydrolytic ability of Rho GTPases. GRAF enhances the hydrolysis of GTPases and converts GTPases from an active form to an inactive form, thereby inhibiting signaling transduction. Deletion and mutation of ARHGAP26 can lead to promyelocytic leukemia, suggesting tumor suppressive activity of ARHGAP26. ARHGAP26 was downregulated in glioblastoma and associated with cell proliferation and migration (PMID: 10908648, PMID: 17611651, PMID: 31004081).

Loading...
||
New chat

Able

正在加载,请稍候...