ARHGAP29 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARHGAP29 Polyclonal antibody, PBS Only (12583-1-PBS)

• 

  WB analysis using 12583-1-AP (same clone as 12583-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 12583-1-AP (ARHGAP29 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12583-1-AP (same clone as 12583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12583-1-AP (ARHGAP29 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12583-1-AP (same clone as 12583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12583-1-AP (ARHGAP29 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12583-1-PBS in a different storage buffer formulation.

ARHGAP29 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12583-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12583-1-PBS targets ARHGAP29 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3282

  Product name: Recombinant human ARHGAP29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC022483

  Sequence: MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIE

• Full Name: Rho GTPase activating protein 29
• Calculated Molecular Weight: 142 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC022483
• Gene Symbol: ARHGAP29
• Gene ID (NCBI): 9411
• RRID: AB_2918030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q52LW3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.