ARHGAP44 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARHGAP44 Polyclonal antibody, PBS Only (32382-1-PBS)

• 

  WB analysis using 32382-1-AP (same clone as 32382-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32382-1-AP (ARHGAP44 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32382-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32382-1-AP (same clone as 32382-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32382-1-AP (ARHGAP44 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32382-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 32382-1-AP (same clone as 32382-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 32382-1-AP (ARHGAP44 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32382-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 32382-1-AP (same clone as 32382-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 32382-1-AP (ARHGAP44 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32382-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 32382-1-AP (same clone as 32382-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ARHGAP44 antibody (32382-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32382-1-PBS in a different storage buffer formulation.

ARHGAP44 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32382-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA0672, NPC-A-10, Rho GTPase Activating Protein 44, Rho GTPase-activating protein 44, Rho GTPase-Activating Protein RICH2

---

Product Information

32382-1-PBS targets ARHGAP44 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38196

  Product name: Recombinant human ARHGAP44 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 580-772 aa of NM_001321166

  Sequence: LQPGPERTSTTKSKELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST

• Full Name: Rho-type GTPase-activating protein RICH2
• Calculated Molecular Weight: 818aa, 89 kDa
• Observed Molecular Weight: 80-100 kDa
• GenBank Accession Number: NM_001321166
• Gene Symbol: RICH2
• Gene ID (NCBI): 9912
• RRID: AB_3742591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q17R89
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rho GTPase-activating protein 44 (ARHGAP44) belongs to the Rho GTPase-activating protein (RhoGAP) family, also known as Rich2.ARHGAP44 plays an important role in cytoskeletal dynamics, cellular motility and signaling. Its high expression in osteosarcoma correlates with tumor malignancy, suggesting its potential as a potential therapeutic target. In addition, ARHGAP44 may also be involved in the pathogenesis of diabetes and cardiovascular diseases, and its specific role in these diseases needs to be further investigated in the future.