Tested Applications
| Positive WB detected in | Jurkat cells, A431 cells, mouse pancreas tissue, HL-60 cells, HeLa cells, HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10509-1-Ig targets RhoGDI in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0791 Product name: Recombinant human ARHGDIA,aGDI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC005851 Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD Predict reactive species |
| Full Name | Rho GDP dissociation inhibitor (GDI) alpha |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC005851 |
| Gene Symbol | RhoGDI |
| Gene ID (NCBI) | 396 |
| RRID | AB_2059582 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P52565 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rho GDP-dissociation inhibitor (RhoGDI), also called ARHGDIA, is one member of ARHGDIs, which is ubiquitously expressed and interacts with several Rho GTPases, mainly including RhoA, Rac1, and Cdc42. RhoGDI can inhibit nucleotide exchange and membrane association to downregulate the activities of Rho family GTPase. It is overexpressed in various human cancers. Activity of this protein is important in a variety of cellular processes, and it is overexpressed in various human cancers. Mutations in RhoGDI have been found in individuals with nephrotic syndrome, type 8.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RhoGDI antibody 10509-1-Ig | Download protocol |
| WB protocol for RhoGDI antibody 10509-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RhoGDI Polyclonal antibody (Cat# 10509-1-Ig) has 11 citations published in journals including Cancer Research, Experimental & Molecular Medicine, Journal of Experimental & Clinical Cancer Research, Oncotarget, Scientific Reports, PLoS ONE, Journal of Proteome Research, Tumour Biology, and Journal of Agricultural and Food Chemistry. Research fields span oncology (lung, nasopharyngeal, melanoma, and hepatocellular carcinoma), proteomics, cardiovascular biology, neurology, and intervertebral disc degeneration.
| Species | Application | Title |
|---|---|---|
Cancer Res miR-483-5p Promotes Invasion and Metastasis of Lung Adenocarcinoma by Targeting RhoGDI1 and ALCAM.
| ||
Exp Mol Med Involvement of DJ-1 in the pathogenesis of intervertebral disc degeneration via hexokinase 2-mediated mitophagy | ||
J Exp Clin Cancer Res Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway. | ||
J Agric Food Chem A Proteomic Study Reveals a Co-occurrence of Gallic Acid-induced Apoptosis and Glycolysis in B16F10 Melanoma Cells. | ||
Oncotarget Upregulated long non-coding RNA AFAP1-AS1 expression is associated with progression and poor prognosis of nasopharyngeal carcinoma. | ||
Sci Rep Nicotine facilitates VSMC dysfunction through a miR-200b/RhoGDIA/cytoskeleton module. |
Reviews
What customers say
One reviewer (Udesh Dhawan) rated this antibody 5 out of 5 stars for Western Blot. They used it at a 1:2000 dilution on Glioblastoma (GBM) cells and reported that it "worked well." The review was posted in November 2023 with lot 00015683. Overall, the single review reflects a positive experience with strong performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (11-26-2023) | Worked well at 1:2000 for Glioblastoma cells
|





















