ARID3A Monoclonal antibody, PBS Only

ARID3A Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68428-1-PBS
Clone No.2B10C10

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Dead ringer-like protein 1, BRIGHT, B-cell regulator of IgH transcription, AT-rich interactive domain-containing protein 3A, ARID domain-containing protein 3A

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68428-1-PBS targets ARID3A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7655

Product name: Recombinant human ARID3A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 244-593 aa of BC060828

Sequence: FLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP

Predict reactive species
Full Name AT rich interactive domain 3A (BRIGHT-like)
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC060828
Gene Symbol ARID3A
Gene ID (NCBI) 1820
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99856
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARID3A is a nuclear matrix-associated transcription factor that stimulates immunoglobulin heavy chain (IgH) expression and Cyclin E1/E2F-dependent cell cycle progression. It activates IgH transcriptional initiation by binding to ATC-rich P sites within nuclear matrix attachment regions (MARs) flanking the IgH intronic enhancer (Emu) (PMID:17386101). It is the founder of the 13-member (in humans) ARID (AT-Rich Interaction Domain) family, which share a highly conserved DNA binding domain, but functions in diverse biological processes such as cell cycle regulated events, epigenetic post-translational modification, and chromatin remodeling (PMID:15927959,11959810,11283269). The expression molecular weight observed is consistent with what has been described in the literature (PMID: 15922553, 19436740).

Loading...
||
New chat Able
正在加载,请稍候...