ARK5 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A431 using 84893-5-RR (same clone as 84893-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NUAK1 antibody (84893-5-RR, Clone: 242411F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84893-5-PBS in a different storage buffer formulation.

ARK5 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84893-5-PBS

Clone No.242411F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

NUAK1, NUAK family SNF1-like kinase 1, NUAK 1, EC:2.7.11.1, AMPK-related protein kinase 5

---

Product Information

84893-5-PBS targets ARK5 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18832

  Product name: Recombinant human NUAK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 515-662 aa of BC152462

  Sequence: HSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN

• Full Name: NUAK family, SNF1-like kinase, 1
• Calculated Molecular Weight: 661 aa, 74 kDa
• GenBank Accession Number: BC152462
• Gene Symbol: ARK5
• Gene ID (NCBI): 9891
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60285
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUAK1 is a member of the human adenosine monophosphate (AMP)-activated protein kinase family that has been identified as a key tumor cell survival factor. It is also named as ARK5, KIAA0537, OMPHK1 and belongs to the protein kinase superfamily. The physiological role of NUAK1 is potentially to suppress glucose uptake through negative regulation of INS signaling in oxidative muscle. This protein has 2 isoforms produced by alternative splicing.