ARL1 Polyclonal antibody

• 

  WB analysis using 16012-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16012-1-AP (ARL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16012-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16012-1-AP (ARL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 16012-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16012-1-AP (ARL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16012-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16012-1-AP (ARL1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16012-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16012-1-AP (ARL1 antibody) at dilution of 1:4500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Neuro-2a using 16012-1-AP

  IP result of anti-ARL1 (IP:16012-1-AP, 4ug; Detection:16012-1-AP 1:4000) with Neuro-2a cells lysate 2400 ug.

• 

  IHC staining of mouse brain using 16012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16012-1-AP (ARL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 16012-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16012-1-AP (ARL1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 16012-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ARL1 antibody (16012-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

ARL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16012-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ADP ribosylation factor like 1, ADP-ribosylation factor-like protein 1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, K-562 cells, HeLa cells, mouse liver tissue, HepG2 cells, Neuro-2a cells, C6 cells
• Positive IP detected in: Neuro-2a cells
• Positive IHC detected in: human stomach cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 12 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

16012-1-AP targets ARL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8770

  Product name: Recombinant human ARL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC007000

  Sequence: MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ

• Full Name: ADP-ribosylation factor-like 1
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC007000
• Gene Symbol: ARL1
• Gene ID (NCBI): 400
• RRID: AB_2243131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40616
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins; Authors - Huaqing Deng
human	WB	Nature; FSP1 is a glutathione-independent ferroptosis suppressor.; Authors - Sebastian Doll
human	WB,IP	Nat Protoc; Proteome-wide analysis of protein lipidation using chemical probes: in-gel fluorescence visualization, identification and quantification of N-myristoylation, N- and S-acylation, O-cholesterylation, S-farnesylation and S-geranylgeranylation.; Authors - Wouter W Kallemeijn
human	WB	Nat Commun; Rab27a co-ordinates actin-dependent transport by controlling organelle-associated motors and track assembly proteins.; Authors - Noura Alzahofi
human	WB	J Cell Biol; ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network.; Authors - Morié Ishida ; KO Validated
human	IF	Cell Rep; Role for the IFT-A Complex in Selective Transport to the Primary Cilium.; Authors - Wenxiang Fu