ARL15 Polyclonal antibody

• 

  WB analysis of mouse thymus using 11934-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11934-1-AP (ARL15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse thymus using 11934-1-AP

  IP result of anti-ARL15 (IP:11934-1-AP, 4ug; Detection:11934-1-AP 1:300) with mouse thymus tissue lysate 4000 ug.

• 

  IHC staining of human lymphoma using 11934-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11934-1-AP (ARL15 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

ARL15 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11934-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

ARF related protein 2, ARFRP2, ARL15

---

Tested Applications

• Positive WB detected in: mouse thymus tissue
• Positive IP detected in: mouse thymus tissue
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

11934-1-AP targets ARL15 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2530

  Product name: Recombinant human ARL15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC026093

  Sequence: MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM

• Full Name: ADP-ribosylation factor-like 15
• Calculated Molecular Weight: 204 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC026093
• Gene Symbol: ARL15
• Gene ID (NCBI): 54622
• RRID: AB_2227438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARL15(ADP-ribosylation factor-like protein 15) is also named as ARFRP2(ADP-ribosylation factor-related protein 2) and belongs to the small GTPase superfamily and Arf familiy.ADP-ribosylation factor-related protein (ARP) is a membrane-associated GTPase with remote similarity to the family of ADP-ribosylation factors (ARF)(PMID:10092663). Arl15 is present in chordates but not lower eukaryotes. Arl15 lacks a site for Nmyristoylation, but the N-terminal region contains several well-conserved cysteines, suggesting that it may bepalmitoylated(PMID:17506703).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS Genet; A genome-wide association study reveals variants in ARL15 that influence adiponectin levels.; Authors - Richards J Brent JB
mouse	IP	PLoS Biol; CNNM proteins selectively bind to the TRPM7 channel to stimulate divalent cation entry into cells.; Authors - Zhiyong Bai ; KD Validated
human	IHC	Biochem Biophys Res Commun; ADP-ribosylation factor-like GTPase 15 enhances insulin-induced AKT phosphorylation in the IR/IRS1/AKT pathway by interacting with ASAP2 and regulating PDPK1 activity.; Authors - Jie Zhao
human	WB	Life Sci; PMID: 30682341; Authors - Jiayi Shen ; KD Validated