ARL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARL3 Polyclonal antibody (10961-1-AP)

• Featured Product
• KD/KO Validated

ARL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10961-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ADP ribosylation factor like 3, ADP-ribosylation factor-like protein 3

• 

  WB analysis using 10961-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10961-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 10961-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10961-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 10961-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 10961-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 10961-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 10961-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10961-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10961-1-AP (ARL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 10961-1-AP

  IP result of anti-ARL3 (IP:10961-1-AP, 4ug; Detection:10961-1-AP 1:1000) with mouse brain tissue lysate 1680 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10961-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10961-1-AP (ARL3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10961-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10961-1-AP (ARL3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10961-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10961-1-AP (ARL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10961-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10961-1-AP (ARL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of IMCD3 cells using 10961-1-AP

  IF result of 10961-1-AP (anti-ARL3,Green) in ciliated IMCD3 cells by Dr. Seongjin Seo. (Red is the primary cilium, and blue is the nucleus).

• 

  IF Staining of hTERT-RPE1 using 10961-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using ARL3 antibody (10961-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MDCK using 10961-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using ARL3 antibody (10961-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, PC-3 cells, human brain tissue, mouse testis tissue, rat brain tissue, HeLa cells, rat testis tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MDCK cells, IMCD3 cells, hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10961-1-AP targets ARL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1406

  Product name: Recombinant human ARL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-182 aa of BC009841

  Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

• Full Name: ADP-ribosylation factor-like 3
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa, 25 kDa
• GenBank Accession Number: BC009841
• Gene Symbol: ARL3
• Gene ID (NCBI): 403
• RRID: AB_2274220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36405
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARL3 (ADP-ribosylation factor-like 3) is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. ARL3 is believed to be involved in ciliary and microtubule-dependent processes.

Publications

What published studies show

The anti-ARL3 antibody (Cat# 10961-1-AP) has 21 citations across journals including Nature Communications, PNAS, Development, eLife, Advances in Science, FASEB Journal, Journal of Biological Chemistry, Experimental Eye Research, Journal of Translational Medicine, and others. Research fields span ciliary biology, cell signaling, cancer (breast, glioma, colorectal), retinal degeneration, spermiogenesis, T-cell immunity, protein trafficking, and mitochondrial dysfunction.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IF	Nat Commun; Arl3 and LC8 regulate dissociation of dynactin from dynein.; Authors - Mingyue Jin ; KD Validated
mouse	WB	Nat Commun; Ciliary membrane proteins traffic through the Golgi via a Rabep1/GGA1/Arl3-dependent mechanism.; Authors - Hyunho Kim ; KD Validated
human	WB,IF	Nat Commun; Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation.; Authors - Antonios D Konitsiotis
human	WB,IF	Nat Commun; A stress-induced cilium-to-PML-NB route drives senescence initiation; Authors - Xiaoyu Ma
human	IHC,IF	Adv Sci (Weinh); ARL3 Enhances ERα Stability via USP10 Deubiquitination to Promote Endocrine Resistance and Drive Mitochondrial Metabolic Reprogramming in HR+ Breast Cancer; Authors - Han Li
human	WB	J Transl Med; ARL3 is downregulated and acts as a prognostic biomarker in glioma.; Authors - Yulin Wang