ARL4D Polyclonal antibody

• 

  WB analysis using 15267-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15267-1-AP (ARL4D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ARL4D Polyclonal Antibody for WB, ELISA

Cat No. 15267-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ARF4L, ARL4D, ARL6

---

Tested Applications

• Positive WB detected in: mouse retina tissue, Y79 cells, rat retina tiissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15267-1-AP targets ARL4D in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7369

  Product name: Recombinant human ARL4D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC000043

  Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR

• Full Name: ADP-ribosylation factor-like 4D
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC000043
• Gene Symbol: ARL4D
• Gene ID (NCBI): 379
• RRID: AB_3669203
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49703
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARL4D (ADP-ribosylation factor-like protein 4D) is also named as ARF4L. ARL4D is a developmentally regulated member of the ADP-ribosylation factor/ARF-like protein (ARF/ARL) family of Ras-related GTPases. ARL4D interacts with the C-terminal pleckstrin homology (PH) and polybasic c domains of cytohesin-2/ARNO in a GTP-dependent manner. Localization of ARL4D at the plasma membrane is GTP- and N-terminal myristoylation-dependent. ARL4D(Q80L), a putative active form of ARL4D, induced accumulation of cytohesin-2/ARNO at the plasma membrane  (PMID: 17804820).