ARL5B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ARL5B Polyclonal antibody, PBS Only (11694-1-PBS)

• 

  WB analysis of U2OS using 11694-1-AP (same clone as 11694-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 11694-1-AP (ARL5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11694-1-AP (same clone as 11694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11694-1-AP (ARL5B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11694-1-AP (same clone as 11694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11694-1-AP (ARL5B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11694-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARL5B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ARL8, ADP-ribosylation factor-like protein 8, ADP-ribosylation factor-like protein 5B

---

Product Information

11694-1-PBS targets ARL5B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2309

  Product name: Recombinant human ARL5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-179 aa of BC024163

  Sequence: MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR

• Full Name: ADP-ribosylation factor-like 5B
• Calculated Molecular Weight: 179 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC024163
• Gene Symbol: ARL5B
• Gene ID (NCBI): 221079
• RRID: AB_2058835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARL5B, also known as ADP ribosylation factor-like GTPase 5B, is a small G protein that is localized to the trans-Golgi network (TGN) in mammalian cells. It plays a significant role in the regulation of retrograde membrane transport from endosomes back to the TGN. This function is particularly important for the maintenance of cellular membrane traffic and the organization of the Golgi apparatus.