• Featured Product
  • KD/KO Validated

ARL8B Polyclonal antibody

ARL8B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 13049-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, ARL10C, EC:3.6.5.2, GIE1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, human brain tissue, mouse brain tissue, NIH/3T3 cells
Positive IHC detected inmouse brain tissue, human stomach cancer tissue, mouse kidney tissue, rat pancreas tissue, rat stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13049-1-AP targets ARL8B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3711

Product name: Recombinant human ARL8B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-186 aa of BC013131

Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Predict reactive species
Full Name ADP-ribosylation factor-like 8B
Calculated Molecular Weight 186 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC013131
Gene Symbol ARL8B
Gene ID (NCBI) 55207
RRIDAB_2059000
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NVJ2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARL8B ( ADP-ribosylation factor-like 8B) , also known as ARL10C or GIE1, is a small GTPase of the Arl-family, that is associated with the lysosome. ARL8A interacts with Tubulin, and plays a role in lysosome motility, as well as in chromosomal segregation. ARL8B plays a role in the spatial distribution and positioning of lysosomes. ARL8B is regarded as a regulator of endosome to lysosome trafficking pathways of special significance for host defense.

Protocols

Product Specific Protocols
IF protocol for ARL8B antibody 13049-1-APDownload protocol
IHC protocol for ARL8B antibody 13049-1-APDownload protocol
WB protocol for ARL8B antibody 13049-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Lysosomal positioning coordinates cellular nutrient responses.

Authors - Korolchuk Viktor I VI
  • KD Validated
humanWB

Nat Commun

DENND6A links Arl8b to a Rab34/RILP/dynein complex, regulating lysosomal positioning and autophagy

Authors - Rahul Kumar
ratIF

Nat Commun

Spatiotemporal proteomics reveals the biosynthetic lysosomal membrane protein interactome in neurons

Authors - Chun Hei Li
  • KD Validated
mouseWB,IF

Sci Adv

Endosomal sorting drives the formation of axonal prion protein endoggresomes.

Authors - Romain Chassefeyre
  • KO Validated
monkeyWB

Sci Adv

The structure and global distribution of the endoplasmic reticulum network are actively regulated by lysosomes.

Authors - Meng Lu
  • KD Validated
humanWB

Nat Commun

RUFY3 and RUFY4 are ARL8 effectors that promote coupling of endolysosomes to dynein-dynactin.

Authors - Tal Keren-Kaplan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Olivia (Verified Customer) (01-08-2020)

WB: Lysates from mouse bone marrow-derived macrophages were subjected to SDS PAGE followed by western blot with 13049-1-AP(Arl8b antibody) at a dilution of 1:500 overnight at 4°C.IF: Mouse bone marrow-derived macrophages were fixed in 4% PFA and permeabilized with 0.5% saponin before incubation with 1:500 Arl8b antibody (in 1% BSA/0.1% saponin/PBS) overnight at 4°C, followed by incubation with anti-rabbit Alexa Fluor 568 for 1h at room temperature.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse bone marrow-derived macrophages
ARL8B Antibody Western Blot,Immunofluorescence, validation (1:500 dilution) in Mouse bone marrow-derived macrophages (Cat no:13049-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...