• Featured Product
  • KD/KO Validated

ARNT2 Polyclonal antibody

ARNT2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 12810-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

ARNT protein 2, ARNT2, bHLHe1, KIAA0307

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, Raji cells
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12810-1-AP targets ARNT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3536

Product name: Recombinant human ARNT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 363-716 aa of BC036099

Sequence: QDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPGNEWWSPHSRQHFRQPISYARM

Predict reactive species
Full Name aryl-hydrocarbon receptor nuclear translocator 2
Calculated Molecular Weight 716 aa, 79 kDa
Observed Molecular Weight 80-85 kDa
GenBank Accession NumberBC036099
Gene Symbol ARNT2
Gene ID (NCBI) 9915
RRIDAB_2059456
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HBZ2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aryl-hydrocarbon receptor nuclear translocator 2(ARNT2), is a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. It specifically recognizes the xenobiotic response element(XRE). ARNT2 plays an important role in normal glucose handling in pancreatic beta cell function in humans and mice. ARNT2 proteins are dimeric partners for other PAS proteins such as HIF and SIM. ARNT2 and the other ARNT family members, e.g., ARNT, hypoxin inducible factor 1α (HIF1α), HIF2α, and aryl hydrocarbon receptor (AhR), are thought to function as heterodimers, and regulate the expression, and thereby the function, of many genes. Under hypoxic conditions, it complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. Modulation of ARNT2 in pancreatic beta cells affects glucose stimulated INS secretion (GSIS). This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ARNT2.

Protocols

Product Specific Protocols
WB protocol for ARNT2 antibody 12810-1-APDownload protocol
IHC protocol for ARNT2 antibody 12810-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Cell Rep

Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription

Authors - Wen-Juan Li
mouseWB

Front Microbiol

Fine Particulate Matter (PM2.5) Promotes CD146 Expression in Alveolar Epithelial Cells and Cryptococcus neoformans Pulmonary Infection.

Authors - Zhixiao Sun
human,mouseWB

Res Sq

MYC-Mediated Inhibition of ARNT2 Uncovers a Key Tumor Suppressor in Glioblastoma

Authors - Maralice Conacci-Sorrell
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kristina (Verified Customer) (12-16-2019)

Works well for WB analysis on MDA-MB-231 and 293T cells. Very clean.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mammalian cells
Loading...
||
New chat Able
正在加载,请稍候...