Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, Raji cells |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12810-1-AP targets ARNT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3536 Product name: Recombinant human ARNT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 363-716 aa of BC036099 Sequence: QDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPGNEWWSPHSRQHFRQPISYARM Predict reactive species |
| Full Name | aryl-hydrocarbon receptor nuclear translocator 2 |
| Calculated Molecular Weight | 716 aa, 79 kDa |
| Observed Molecular Weight | 80-85 kDa |
| GenBank Accession Number | BC036099 |
| Gene Symbol | ARNT2 |
| Gene ID (NCBI) | 9915 |
| RRID | AB_2059456 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HBZ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Aryl-hydrocarbon receptor nuclear translocator 2(ARNT2), is a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. It specifically recognizes the xenobiotic response element(XRE). ARNT2 plays an important role in normal glucose handling in pancreatic beta cell function in humans and mice. ARNT2 proteins are dimeric partners for other PAS proteins such as HIF and SIM. ARNT2 and the other ARNT family members, e.g., ARNT, hypoxin inducible factor 1α (HIF1α), HIF2α, and aryl hydrocarbon receptor (AhR), are thought to function as heterodimers, and regulate the expression, and thereby the function, of many genes. Under hypoxic conditions, it complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. Modulation of ARNT2 in pancreatic beta cells affects glucose stimulated INS secretion (GSIS). This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ARNT2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ARNT2 antibody 12810-1-AP | Download protocol |
| WB protocol for ARNT2 antibody 12810-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ARNT2 Polyclonal Antibody (Cat# 12810-1-AP) has 5 citations published in Cell Communications & Signaling, Cell Reports, Translational Psychiatry, Frontiers in Microbiology, and Research Square. Research fields span glioblastoma and neuronal identity, hypoxia-driven breast tumorigenesis, cerebellar perineuronal nets and social behavior, PM2.5-induced pulmonary infection, and MYC-mediated tumor suppression in glioblastoma. Applications cited include WB and IF in human and mouse models.
| Species | Application | Title |
|---|---|---|
Cell Commun Signal ARNT2 repression disrupts neuronal identity and promotes glioblastoma growth.
| ||
Cell Rep Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription | ||
Transl Psychiatry Perineuronal nets in cerebellar nuclei neurons orchestrate social behaviour via regulation of neuronal activity in circuits innervated by the cerebellum. | ||
Front Microbiol Fine Particulate Matter (PM2.5) Promotes CD146 Expression in Alveolar Epithelial Cells and Cryptococcus neoformans Pulmonary Infection. | ||
Res Sq MYC-Mediated Inhibition of ARNT2 Uncovers a Key Tumor Suppressor in Glioblastoma
|
Reviews
What customers say
The single review for this product is a 5-star rating. The reviewer reported excellent performance in Western Blot analysis using MDA-MB-231 and 293T cell lysates at a 1:500 dilution, noting that the antibody produced very clean results with no mention of background or nonspecific binding issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kristina (Verified Customer) (12-16-2019) | Works well for WB analysis on MDA-MB-231 and 293T cells. Very clean.
|
