ARNTL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARNTL2 Polyclonal antibody (23908-1-AP)

• 

  WB analysis using 23908-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23908-1-AP (ARNTL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ARNTL2 Polyclonal Antibody for WB, ELISA

Cat No. 23908-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bHLHe6, BMAL2, Brain and muscle ARNT like 2, CLIF, CYCLE like factor

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HCT 116 cells, HT-29 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23908-1-AP targets ARNTL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21003

  Product name: Recombinant human ARNTL2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 391-578 aa of BC000172

  Sequence: SQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL

• Full Name: aryl hydrocarbon receptor nuclear translocator-like 2
• Calculated Molecular Weight: 636 aa, 71 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC000172
• Gene Symbol: ARNTL2
• Gene ID (NCBI): 56938
• RRID: AB_3742097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8WYA1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARNTL2 (Aryl Hydrocarbon Receptor Nuclear Translocator Like 2), also known as BMAL2 (Brain and Muscle ARNT-Like 2), is a core component of the circadian clock genes within the PAS (PER, ARNT, SIM) superfamily (PMID: 27671790). ARNTL2 has also been demonstrated to play an essential role in various tumors, it is associated with poor survival and immune infiltration in clear cell renal cell carcinoma and triple-Negative Breast Cancer (PMID: 34785930). Besides, ARNTL2 has also been found to promote metastasis of colon carcinoma and estrogen Receptor-Negative Breast Cancer (PMID: 27656887).