ARPC5L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARPC5L Polyclonal antibody (22025-1-AP)

ARPC5L Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22025-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Actin-related protein 2/3 complex subunit 5-like protein, ARC16-2

• 

  WB analysis using 22025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22025-1-AP (ARPC5L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 22025-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 22025-1-AP (ARPC5L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 22025-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 22025-1-AP (ARPC5L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 22025-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 22025-1-AP (ARPC5L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 22025-1-AP

  IP result of anti-ARPC5L (IP:22025-1-AP, 4ug; Detection:22025-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 22025-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 22025-1-AP (ARPC5L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 22025-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 22025-1-AP (ARPC5L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 22025-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ARPC5L antibody (22025-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARPC5L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, NIH/3T3 cells, mouse lung tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22025-1-AP targets ARPC5L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16881

  Product name: Recombinant human ARPC5L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC000798

  Sequence: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV

• Full Name: actin related protein 2/3 complex, subunit 5-like
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC000798
• Gene Symbol: ARPC5L
• Gene ID (NCBI): 81873
• RRID: AB_11182273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARPC5L, also known as ARC16-2, belongs to the ARPC5 family. ARPC5L is involved in Arp2/3 complex-mediated actin nucleation and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ARPC5L-containing Arp2/3 complexes are required for the peripheral positioning of nuclei in myofibers (PMID: 28892082). The molecular mass of ARPC5L is 17-20 kDa.

Publications

What published studies show

The ARPC5L Polyclonal antibody (Cat# 22025-1-AP) has 1 total citation. It appears in Pigment Cell Melanoma Research (Impact Factor 3.5), published in September 2021. The cited study investigated YAP's role in facilitating melanoma migration through regulation of ARPC5, an actin-related protein 2/3 complex subunit. The research field is melanoma biology and actin cytoskeleton regulation. The antibody was used in Western blot and immunofluorescence applications on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Pigment Cell Melanoma Res; YAP facilitates melanoma migration through regulation of actin-related protein 2/3 complex subunit 5 (ARPC5); Authors - Jason W. Lui