Tested Applications
| Positive WB detected in | Jurkat cells, A375 cells, A549 cells, mouse brain tissue, rat skeletal muscle tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11678-1-AP targets ARPP-19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2279 Product name: Recombinant human ARPP-19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC003418 Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG Predict reactive species |
| Full Name | cyclic AMP phosphoprotein, 19 kD |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC003418 |
| Gene Symbol | ARPP-19 |
| Gene ID (NCBI) | 10776 |
| RRID | AB_2060078 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56211 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARPP-19, a 19-kDa cAMP-regulated phosphoprotein, plays a role in regulating mitosis. Initiation and maintenance of mitosis require the activation of protein kinase cyclin B-Cdc2 and the inhibition of protein phosphatase 2A (PP2A). When phosphorylated by protein kinase Greatwall (Gwl), ARPP-19 associate with and inhibit PP2A, thus promoting mitotic entry. ARPP-19 may be an important link between nerve growth factor (NGF) signaling and post-transcriptional control of neuronal gene expression such as GAP-43.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| IHC protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| IP protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| WB protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ARPP-19 Polyclonal antibody (Cat# 11678-1-AP) has 8 citations, all in human studies using WB, IHC, and IP. Journals include Nature, Communications Biology, International Journal of Molecular Sciences, Cancers, Journal of Proteome Research, Frontiers in Oncology, OncoTargets and Therapy, and Quantitative Biology. Research fields span cell-cycle and mitosis regulation, phosphoproteomics, and cancer biology—specifically hepatocellular carcinoma, acute myeloid leukemia, and gastric cancer.
| Species | Application | Title |
|---|---|---|
Cancers (Basel) Arpp19 Promotes Myc and Cip2a Expression and Associates with Patient Relapse in Acute Myeloid Leukemia.
| ||
J Proteome Res Phosphoproteome Profiling Revealed the Importance of mTOR Inhibition on CDK1 Activation to Further Regulate Cell Cycle Progression. | ||
Front Oncol Identification of Glycolysis-Related lncRNAs and the Novel lncRNA WAC-AS1 Promotes Glycolysis and Tumor Progression in Hepatocellular Carcinoma. |
Reviews
What customers say
All three reviews rated this antibody 5 stars. Users tested it successfully across Western Blot, IHC, IF, IP, and flow cytometry at dilutions ranging from 1:400 to 1:2000. One reviewer noted very clear, sharp bands on human colon cancer cells. Overall, customers described it as an excellent, high-performing antibody with strong results in multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (03-24-2026) | Excellent antibody, great work !!
|
Sai Sindhura (Verified Customer) (01-08-2026) | VERY GOOD ANTIBODY
|
Iram (Verified Customer) (01-15-2021) | ARPP19 antibody giving a very clear sharp bands
|
