ARPP-21 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARPP-21 Polyclonal antibody (11829-1-AP)

ARPP-21 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11829-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ARPP21, ARPP 21, cAMP-regulated phosphoprotein 21, TARPP, Thymocyte cAMP-regulated phosphoprotein

• 

  WB analysis using 11829-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11829-1-AP (ARPP-21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11829-1-AP (ARPP-21 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11829-1-AP (ARPP-21 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 11829-1-AP (ARPP-21 Antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 11829-1-AP (ARPP-21 Antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11829-1-AP targets ARPP-21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2399

  Product name: Recombinant human ARPP-21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC017805

  Sequence: MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQTL

• Full Name: cyclic AMP-regulated phosphoprotein, 21 kD
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC017805
• Gene Symbol: ARPP-21
• Gene ID (NCBI): 10777
• RRID: AB_2877798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARPP-21 is a neuron-enriched signaling protein that was first purified and characterized from dopamine-rich regions of the mammalian brain, particularly the bovine caudate nucleus. It exists as two isoforms, ARPP-21A and ARPP-21B, generated by alternative splicing.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Cell Dev Biol; PERK Signaling Controls Myoblast Differentiation by Regulating MicroRNA Networks.; Authors - Ye-Ya Tan
mouse	WB	Nat Commun; The thymocyte-specific RNA-binding protein Arpp21 provides TCR repertoire diversity by binding to the 3'-UTR and promoting Rag1 mRNA expression; Authors - Meng Xu