ARPP-21 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARPP-21 Polyclonal antibody (11829-1-AP)

ARPP-21 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11829-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ARPP21, ARPP 21, cAMP-regulated phosphoprotein 21, TARPP, Thymocyte cAMP-regulated phosphoprotein

• 

  WB analysis using 11829-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11829-1-AP (ARPP-21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11829-1-AP (ARPP-21 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11829-1-AP (ARPP-21 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 11829-1-AP (ARPP-21 Antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 11829-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 11829-1-AP (ARPP-21 Antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARPP-21 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11829-1-AP targets ARPP-21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2399

  Product name: Recombinant human ARPP-21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC017805

  Sequence: MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQTL

• Full Name: cyclic AMP-regulated phosphoprotein, 21 kD
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC017805
• Gene Symbol: ARPP-21
• Gene ID (NCBI): 10777
• RRID: AB_2877798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARPP-21 is a neuron-enriched signaling protein that was first purified and characterized from dopamine-rich regions of the mammalian brain, particularly the bovine caudate nucleus. It exists as two isoforms, ARPP-21A and ARPP-21B, generated by alternative splicing.

Publications

What published studies show

ARPP-21 Polyclonal antibody (Cat# 11829-1-AP) has 2 citations. One appeared in Nature Communications (2024), studying how ARPP-21 promotes Rag1 mRNA expression to provide TCR repertoire diversity in thymocytes. The other was published in Frontiers in Cell and Developmental Biology (2021), investigating PERK signaling's role in myoblast differentiation via microRNA network regulation. Both studies used the antibody for Western blot in mouse samples, spanning immunology and developmental cell biology research fields.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; The thymocyte-specific RNA-binding protein Arpp21 provides TCR repertoire diversity by binding to the 3'-UTR and promoting Rag1 mRNA expression; Authors - Meng Xu
mouse	WB	Front Cell Dev Biol; PERK Signaling Controls Myoblast Differentiation by Regulating MicroRNA Networks.; Authors - Ye-Ya Tan