Arylsulfatase D Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Arylsulfatase D Polyclonal antibody (11805-1-AP)

Arylsulfatase D Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11805-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

ARSD, Arylsulfatase D, ASD

• 

  WB analysis of human placenta using 11805-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11805-1-AP (Arylsulfatase D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11805-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11805-1-AP (Arylsulfatase D antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Arylsulfatase D in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11805-1-AP targets Arylsulfatase D in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2477

  Product name: Recombinant human ARSD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-593 aa of BC020229

  Sequence: ISWYSSFGFVRRWNCILMRNHDVTEQPMVLEKTASLMLKEAVSYIERHKHGPFLLFLSLLHVHIPLVTTSAFLGKSQHGLYGDNVEEMDWLIGKVLNAIEDNGLKNSTFTYFTSDHGGHLEARDGHSQLGGWNGIYKGGKGMGGWEGGIRVPGIFHWPGVLPAGRVIGEPTSLMDVFPTVVQLVGGEVPQDRVIDGHSLVPLLQGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHEDGDGTP

• Full Name: arylsulfatase D
• Calculated Molecular Weight: 593 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC020229
• Gene Symbol: ARSD
• Gene ID (NCBI): 414
• RRID: AB_2258699
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51689
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Arylsulfatase D Polyclonal antibody (Cat# 11805-1-AP) has 1 citation. It appears in Frontiers in Pharmacology (2022), in a study investigating the ameliorative effect and mechanism of Si-Ni-San on chronic stress-induced diarrhea-predominant irritable bowel syndrome in rats. The research field is pharmacology, specifically related to gastrointestinal disorders and traditional Chinese medicine. The antibody was used for Western blot analysis in rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Pharmacol; Ameliorative effect and mechanism of Si-Ni-San on chronic stress-induced diarrhea-irritable bowel syndrome in rats; Authors - Hui-Yu Chen