AS3MT Polyclonal antibody

• 

  WB analysis of mouse liver using 27270-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27270-1-AP (AS3MT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

AS3MT Polyclonal Antibody for WB, ELISA

Cat No. 27270-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Arsenite methyltransferase, AS3MT, CYT19

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27270-1-AP targets AS3MT in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26194

  Product name: Recombinant human AS3MT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_020682

  Sequence: MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTG

• Full Name: arsenic (+3 oxidation state) methyltransferase
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 39-41 kDa
• GenBank Accession Number: NM_020682
• Gene Symbol: AS3MT
• Gene ID (NCBI): 57412
• RRID: AB_2880824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBK9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.