ASAH2 Polyclonal antibody

• 

  WB analysis using 27742-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 27742-1-AP (ASAH2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

ASAH2 Polyclonal Antibody for WB, ELISA

Cat No. 27742-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, ELISA

Synonyms

Acylsphingosine deacylase 2, ASAH2, hCD, HNAC1, LCDase, N CDase, NCDase, Neutral ceramidase, Non lysosomal ceramidase

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27742-1-AP targets ASAH2 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26908

  Product name: Recombinant human ASAH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-333 aa of BC107105

  Sequence: GVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKG

• Full Name: N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2
• Calculated Molecular Weight: 780 aa, 86 kDa
• Observed Molecular Weight: 100-115 kDa
• GenBank Accession Number: BC107105
• Gene Symbol: ASAH2
• Gene ID (NCBI): 56624
• RRID: AB_2918129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Cancer Prev Res (Phila); Stool Protein Mass Spectrometry Identifies Biomarkers for Early Detection of Diffuse-type Gastric Cancer; Authors - Chi-Lee C Ho
mouse	WB	Life Metab; High temperature ameliorates high-fat diet-induced obesity by promoting ceramide breakdown in skeletal muscle tissue; Authors - Qiankun Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (01-20-2023)

Good antibody

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Mouse small intestine

ASAH2 Antibody Western Blot validation (1:2000 dilution) in Mouse small intestine (Cat no:27742-1-AP)