ASB13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASB13 Polyclonal antibody (25616-1-AP)

• 

  WB analysis using 25616-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25616-1-AP (ASB13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse small intestine using 25616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25616-1-AP (ASB13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 25616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25616-1-AP (ASB13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 25616-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ASB13 antibody (25616-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

ASB13 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25616-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ASB 13, ASB-13

---

Tested Applications

• Positive WB detected in: L02 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

25616-1-AP targets ASB13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22533

  Product name: Recombinant human ASB13 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 5-173 aa of BC012056

  Sequence: AADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAA

• Full Name: ankyrin repeat and SOCS box-containing 13
• Calculated Molecular Weight: 278 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012056
• Gene Symbol: ASB13
• Gene ID (NCBI): 79754
• RRID: AB_2880162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	ACS Omega; Novel Biomarkers for Lymph Node Metastasis and Prognosis of Bladder Cancer by Bioinformatics Analysis.; Authors - Yifan Sun