ASB13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASB13 Polyclonal antibody (25616-1-AP)

ASB13 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25616-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ASB 13, ASB-13

• 

  WB analysis using 25616-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25616-1-AP (ASB13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 25616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25616-1-AP (ASB13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 25616-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25616-1-AP (ASB13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 25616-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ASB13 antibody (25616-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASB13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25616-1-AP targets ASB13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22533

  Product name: Recombinant human ASB13 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 5-173 aa of BC012056

  Sequence: AADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAA

• Full Name: ankyrin repeat and SOCS box-containing 13
• Calculated Molecular Weight: 278 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012056
• Gene Symbol: ASB13
• Gene ID (NCBI): 79754
• RRID: AB_2880162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ASB13 Polyclonal antibody (Cat# 25616-1-AP) has a total of 1 citation. It appears in ACS Omega (Impact Factor 5.2), published in October 2025. The cited study focuses on novel biomarkers for lymph node metastasis and prognosis of bladder cancer through bioinformatics analysis, placing this citation in the research fields of oncology, bladder cancer, and biomarker discovery. The application used in the citation was IHC on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	ACS Omega; Novel Biomarkers for Lymph Node Metastasis and Prognosis of Bladder Cancer by Bioinformatics Analysis.; Authors - Yifan Sun