Home
Products
Primary Antibodies
ASB5 Polyclonal antibody, PBS Only (24031-1-PBS)

Filter: AllWBIF/ICC

WB analysis using 24031-1-AP (same clone as 24031-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 24031-1-AP (ASB5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24031-1-PBS in a different storage buffer formulation.
WB analysis of mouse skeletal muscle using 24031-1-AP (same clone as 24031-1-PBS)
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24031-1-AP (ASB5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24031-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 24031-1-AP (same clone as 24031-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 24031-1-AP (ASB5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24031-1-PBS in a different storage buffer formulation.
WB analysis of mouse skeletal muscle using 24031-1-AP (same clone as 24031-1-PBS)
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24031-1-AP (ASB5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24031-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 24031-1-AP (same clone as 24031-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ASB5 antibody (24031-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 24031-1-PBS in a different storage buffer formulation.

ASB5 Polyclonal antibody, PBS Only

Name: ASB5 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24031-1-PBS

ASB5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24031-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24031-1-PBS targets ASB5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21230 Product name: Recombinant human ASB5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 245-329 aa of BC065710 Sequence: STEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR Predict reactive species
Full Name	ankyrin repeat and SOCS box-containing 5
Calculated Molecular Weight	329 aa, 36 kDa
Observed Molecular Weight	36-40 kDa
GenBank Accession Number	BC065710
Gene Symbol	ASB5
Gene ID (NCBI)	140458
RRID	AB_2879410
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8WWX0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ASB5, also named as Ankyrin repeat and SOCS box-containing 5, is a 329 amino acid protein, which contains a conserved one C-terminal SOCS box motif. Asb5 was significantly upregulated in growing collateral arteries on mRNA and protein level. It has been shown that asb5 is a protein implicated in the initiation of arteriogenesis.