ASB6 Polyclonal antibody

• 

  WB analysis of L02 using 21449-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21449-1-AP (ASB6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 21449-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21449-1-AP (ASB6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 21449-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21449-1-AP (ASB6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ASB6 Polyclonal Antibody for WB, ELISA

Cat No. 21449-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ASB 6, ASB6

---

Tested Applications

• Positive WB detected in: L02 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

21449-1-AP targets ASB6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13863

  Product name: Recombinant human ASB6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC001719

  Sequence: MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKE

• Full Name: ankyrin repeat and SOCS box-containing 6
• Calculated Molecular Weight: 421 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC001719
• Gene Symbol: ASB6
• Gene ID (NCBI): 140459
• RRID: AB_2878860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; CUL5-ASB6 Complex Promotes p62/SQSTM1 Ubiquitination and Degradation to Regulate Cell Proliferation and Autophagy.; Authors - Liyan Gong
human	WB	J Cancer; ASB6 as an Independent Prognostic Biomarker for Colorectal Cancer Progression Involves Lymphatic Invasion and Immune Infiltration; Authors - Qingyong Hu ; KO Validated