SLC10A2/ASBT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC10A2/ASBT Polyclonal antibody (25245-1-AP)

SLC10A2/ASBT Polyclonal Antibody for WB, IP, ELISA

Cat No. 25245-1-AP Copied!

Publications (30)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ASBT, SLC10A2, Apical sodium-dependent bile acid transporter, Na(+)-dependent ileal bile acid transporter, ISBT

• 

  WB analysis of mouse small intestine using 25245-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 25245-1-AP (ASBT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 25245-1-AP

  IP result of anti-ASBT (IP:25245-1-AP, 4ug; Detection:25245-1-AP 1:300) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC10A2/ASBT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25245-1-AP targets SLC10A2/ASBT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18808

  Product name: Recombinant human SLC10A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 292-348 aa of BC130523

  Sequence: IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK

• Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 2
• Calculated Molecular Weight: 348 aa, 38 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC130523
• Gene Symbol: ASBT
• Gene ID (NCBI): 6555
• RRID: AB_2879986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12908
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC10A2 also known as ASBT, ISBT, and NTCP2, is a sodium/bile acid cotransporter that is primarily responsible for the uptake of bile acids by apical cells in the distal ileum(PMID: 8661017). Mutations in SLC10A2 cause primary bile acid malabsorption (PBAM) and may be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG)(PMID: 9109432).

Publications

What published studies show

The SLC10A2/ASBT Polyclonal antibody (Cat# 25245-1-AP) has 30 citations across journals including Cell, Gastroenterology, Cell Host Microbe, Nature Communications, Advanced Science, Pharmacological Research, Phytomedicine, JHEP Reports, and Molecular Nutrition & Food Research. Research fields span bile acid metabolism, cholestasis, gut–liver axis signaling, cholesterol/hyperlipidemia, liver injury, colorectal cancer, gut microbiota modulation, and drug delivery/nanomedicine.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; An anaerobic pathogen rewires host metabolism to fuel oxidative growth in the inflamed gut.; Authors - Luisella Spiga
mouse	WB	Gastroenterology; Solute Carrier Organic Anion Transporter Family Member 3A1 Is a Bile Acid Efflux Transporter in Cholestasis.; Authors - Qiong Pan
human,mouse	WB,IHC	Cell Host Microbe; Veillonella intestinal colonization promotes C. difficile infection in Crohn's disease; Authors - Ziyu Yang
mouse	WB	Nat Commun; Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice; Authors - Xiaoxue Jiang
	WB	Nat Commun; Bile acids-mediated intracellular cholesterol transport promotes intestinal cholesterol absorption and NPC1L1 recycling; Authors - Jian Xiao
human, mouse	WB,IHC	Adv Sci (Weinh); The KDM6B/SLC10A2 Axis Suppresses MDSCs Recruitment via ERK/AP-1 Signaling in Colorectal Cancer.; Authors - Zhibo Hu ; KD Validated

Reviews

1.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is negative, with a 1-star rating. The user tested it by Western Blot at a 1:500 dilution on mouse liver, mouse small intestine, mouse kidney, and HepG2 cells, and reported that it did not work as expected. No further details were provided.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Hua (Verified Customer) (12-01-2020)

It does not work as expected.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse liver, mouse small intestine, mouse kidney, HepG2

SLC10A2/ASBT Antibody Western Blot validation (1:500 dilution) in Mouse liver, mouse small intestine, mouse kidney, HepG2 (Cat no:25245-1-AP)