ASC/TMS1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ASC/TMS1 Recombinant monoclonal antibody, PBS Only (88328-1-PBS)

ASC/TMS1 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 88328-1-PBS

Clone No.260842C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

PYCARD, Apoptosis-associated speck-like protein containing a CARD, ASC, CARD5, Caspase recruitment domain-containing protein 5

• 

  WB analysis using 88328-1-RR (same clone as 88328-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88328-1-RR (TMS1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88328-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HL-60 using 88328-1-RR (same clone as 88328-1-PBS)

  IP result of anti-ASC/TMS1 (IP:88328-1-RR, 4ug; Detection:88328-1-RR 1:3000) with HL-60 cells lysate 1200 ug. This data was developed using the same antibody clone with 88328-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 88328-1-RR (same clone as 88328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 88328-1-RR (ASC/TMS1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88328-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 88328-1-RR (same clone as 88328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 88328-1-RR (ASC/TMS1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88328-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88328-1-PBS targets ASC/TMS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0774

  Product name: Recombinant human TMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC004470

  Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

• Full Name: PYD and CARD domain containing
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 15-22 kDa
• GenBank Accession Number: BC004470
• Gene Symbol: ASC/TMS1
• Gene ID (NCBI): 29108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULZ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9. TMS1/ASC has different isoforms: ASC, ASC-b and ASC-c (PMID: 20482797).