Product Information
85130-5-PBS targets ASCC3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag11848 Product name: Recombinant human ASCC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC050681 Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR Predict reactive species |
| Full Name | activating signal cointegrator 1 complex subunit 3 |
| Calculated Molecular Weight | 111 aa, 13 kDa, 251 kDa |
| Observed Molecular Weight | 245 kDa |
| GenBank Accession Number | BC050681 |
| Gene Symbol | ASCC3 |
| Gene ID (NCBI) | 10973 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8N3C0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.
