ASIC1 Recombinant monoclonal antibody, PBS Only (Capture)

ASIC1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85089-1-PBS
Clone No.242749B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

ACCN2, 242749B11, Acid-sensing ion channel 1, Amiloride-sensitive cation channel 2, neuronal, ASIC

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85089-1-PBS targets ASIC1 as part of a matched antibody pair:

MP01789-1: 85089-1-PBS capture and 85089-3-PBS detection (validated in Cytometric bead array)

MP01789-2: 85089-1-PBS capture and 85089-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25941

Product name: Recombinant human ASIC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 464-528 aa of NM_001095

Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

Predict reactive species
Full Name amiloride-sensitive cation channel 2, neuronal
Calculated Molecular Weight 60 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberNM_001095
Gene Symbol ASIC1
Gene ID (NCBI) 41
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP78348
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).

Loading...
||
New chat Able
正在加载,请稍候...