ASIC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ASIC3 Polyclonal antibody, PBS Only (28093-1-PBS)

• 

  WB analysis using 28093-1-AP (same clone as 28093-1-PBS)

  Mouse kidney tissue lysate was subjected to SDS PAGE followed by western blot with 28093-1-AP (ASIC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28093-1-PBS in a different storage buffer formulation.

ASIC3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28093-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

ACCN3, Acid sensing ion channel 3, Acid-sensing ion channel 3, Amiloride-sensitive cation channel 3, DRASIC

---

Product Information

28093-1-PBS targets ASIC3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26092

  Product name: Recombinant human ASIC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-175 aa of NM_004769

  Sequence: MLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPEN

• Full Name: amiloride-sensitive cation channel 3
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59-70 kDa
• GenBank Accession Number: NM_004769
• Gene Symbol: ACCN3
• Gene ID (NCBI): 9311
• RRID: AB_3742276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHC3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.