ASK1 Polyclonal antibody

• 

  WB analysis using 28201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28201-1-AP (ASK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 28201-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28201-1-AP (ASK1 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 28201-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28201-1-AP (ASK1 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 28201-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28201-1-AP (ASK1 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 28201-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28201-1-AP (ASK1 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ASK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28201-1-AP

Publications(27)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (3)

Applications

WB, IHC, IP, ELISA

Synonyms

ASK 1, ASK1, MAP3K5, MAPK/ERK kinase kinase 5, MAPKKK5, MEK kinase 5, MEKK 5, MEKK5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, A431 cells, BxPC-3 cells
• Positive IHC detected in: human pancreas cancer tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 26 publications below
• IP: See 1 publications below

Product Information

28201-1-AP targets ASK1 in WB, IHC, IP, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28092

  Product name: Recombinant human ASK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1180-1374 aa of BC054503

  Sequence: LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT

• Full Name: mitogen-activated protein kinase kinase kinase 5
• Calculated Molecular Weight: 155 kDa
• Observed Molecular Weight: 155 kDa
• GenBank Accession Number: BC054503
• Gene Symbol: ASK1
• Gene ID (NCBI): 4217
• RRID: AB_2782957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99683
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASK1(Apoptosis signal-regulating kinase 1) is also named as MAP3K5, MAPKKK5, MEKK5 and belongs to the MAP kinase kinase kinase subfamily. It is an evolutionarily conserved mitogen activated protein 3-kinase that activates both Jnk and p38 mitogen-activated protein kinases. ASK1 is activated in response to various cytotoxic stresses including TNF, Fas and reactive oxygen species (ROS) such as H2O2, and activates c-Jun NH 2-terminal kinase (JNK) and p38. 28201-1-AP antibody detects the 155 kDa band in SDS-PAGE.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Redox Biol; FUT2-dependent fucosylation of HYOU1 protects intestinal stem cells against inflammatory injury by regulating unfolded protein response; Authors - Zhe Wang
rat	WB	Oxid Med Cell Longev; Melatonin Alleviates Neuroinflammation and Metabolic Disorder in DSS-Induced Depression Rats.; Authors - Wei-Jie Lv
mouse	WB	FASEB J; GS-4997 halts the progression of tubulointerstitial injury in lupus nephritis; Authors - Zheng Xiao
rat	WB	J Cell Mol Med; Exercise ameliorates insulin resistance and improves ASK1-mediated insulin signalling in obese rats.; Authors - Yong Zhang
mouse	WB	Food Funct; L-Theanine mediates the p38MAPK signaling pathway to alleviate heat-induced oxidative stress and inflammation in mice.; Authors - Kehong Liu
rat	WB	Life Sci; The IRE1 signaling pathway is involved in the protective effect of low-dose LPS on myocardial ischemia-reperfusion injury.; Authors - Ting Wu