ASNS Recombinant monoclonal antibody

• 

  WB analysis using 85892-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85892-1-RR (ASNS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85892-1-RR

  Cells and lysate were subjected to SDS PAGE followed by western blot with 85892-1-RR (ASNS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 85892-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ASNS antibody (85892-1-RR, Clone: 250177C6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 85892-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85892-1-RR against Human ASNS were performed. The affinity constant is below 1 pM.

ASNS Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85892-1-RR

Clone No.250177C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Asparagine synthetase [glutamine-hydrolyzing], EC:6.3.5.4, Glutamine-dependent asparagine synthetase, TS11

---

Tested Applications

• Positive WB detected in: HeLa cells, HCT 116 cells, K-562 cells, U2OS cells, mouse testis tissue, rat testis tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85892-1-RR targets ASNS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6393

  Product name: Recombinant human ASNS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 247-561 aa of BC014621

  Sequence: LMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA

• Full Name: asparagine synthetase
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 55-64 kDa
• GenBank Accession Number: BC014621
• Gene Symbol: ASNS
• Gene ID (NCBI): 440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08243
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Asparagine synthetase [glutamine-hydrolyzing](ASNS) is also named as TS11. The asparagine synthetase gene, encoding the enzyme that catalyzes the synthesis of asparagine and glutamate using glutamine and aspartate, is a gene for which transcription is highly regulated by the nutritional status of the cell(PMID:15385533). ASNS has some isoforms with the MW of 55-64 kDa.