ASZ1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASZ1 Polyclonal antibody (21550-1-AP)

ASZ1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 21550-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, IP-MS, ELISA

Synonyms

ALP1, ANKL1, Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1, Ankyrin-like protein 1, ASZ 1

• 

  WB analysis of mouse testis using 21550-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 21550-1-AP (ASZ1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 21550-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21550-1-AP (ASZ1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 21550-1-AP

  IP result of anti-ASZ1 (IP:21550-1-AP, 4ug; Detection:21550-1-AP 1:600) with mouse testis tissue lysate 1560 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASZ1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21550-1-AP targets ASZ1 in WB, IF, IP, IP-MS, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16217

  Product name: Recombinant human ASZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-372 aa of BC034963

  Sequence: SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT

• Full Name: ankyrin repeat, SAM and basic leucine zipper domain containing 1
• Calculated Molecular Weight: 475 aa, 53 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC034963
• Gene Symbol: ASZ1
• Gene ID (NCBI): 136991
• RRID: AB_10858622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWH4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ASZ1 polyclonal antibody (Cat# 21550-1-AP) has 9 citations. These appear in Nature Communications, Nucleic Acids Research, PNAS, Developmental Cell, EMBO Journal, Development, Andrology, and bioRxiv. The research fields center on piRNA biogenesis, PIWI protein function, mitochondrial compartmentalization, and male germ cell development during spermatogenesis in mice.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF, WB	Nat Commun; PNLDC1 is essential for piRNA 3' end trimming and transposon silencing during spermatogenesis in mice.; Authors - Deqiang Ding
mouse	IF	Nucleic Acids Res; Mitochondrial membrane-based initial separation of MIWI and MILI functions during pachytene piRNA biogenesis.; Authors - Deqiang Ding
mouse	IP-MS,IF	Proc Natl Acad Sci U S A; Spatiotemporal control of PIWI compartmentalization by mitochondrial scaffolds defines pachytene piRNA pathway organization.; Authors - Xiaoyuan Yan ; KO Validated
mouse	IF	Dev Cell; TDRD1 phase separation drives intermitochondrial cement assembly to promote piRNA biogenesis and fertility; Authors - Jie Gao
	WB,IP,IF	EMBO J; PIWI proteins tether the piRNA biogenesis machinery to mitochondria during mammalian spermatogenesis; Authors - Jie Gao
mouse	WB,IF,IP	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis; Authors -