Use Able AI chat for product recommendations

ATAD1 Monoclonal antibody, PBS Only (Detector)

ATAD1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 60442-2-PBS
Clone No.2A2C3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, Cytometric bead array, Indirect ELISA

2A2C3, AFDC1, ATAD 1, ATPase family AAA domain-containing protein 1, EC:7.4.2.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60442-2-PBS targets ATAD1 as part of a matched antibody pair:

MP50598-1: 60442-1-PBS capture and 60442-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10471

Product name: Recombinant human ATAD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 164-361 aa of BC010868

Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD

Predict reactive species
Full Name ATPase family, AAA domain containing 1
Calculated Molecular Weight 361 aa, 41 kDa
Observed Molecular Weight32-37 kDa
GenBank Accession NumberBC010868
Gene Symbol ATAD1
Gene ID (NCBI) 84896
RRIDAB_3743215
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NBU5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity.

Loading...
||
New chat

Able

正在加载,请稍候...