ATAD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84194-6-RR (same clone as 84194-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84194-6-RR (ATAD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84194-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84194-6-RR (same clone as 84194-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ATAD1 antibody (84194-6-RR, Clone: 241449D12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84194-6-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 84194-6-RR (same clone as 84194-6-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug ATAD1 Recombinant antibody (84194-6-RR, Clone:241449D12) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84194-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84194-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84194-6-RR against Human ATAD1 were performed. The affinity constant is 0.573 nM.

ATAD1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84194-6-PBS

Clone No.241449D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241449D12, AFDC1, ATAD 1, ATPase family AAA domain-containing protein 1, EC:7.4.2.-

---

Product Information

84194-6-PBS targets ATAD1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10343

  Product name: Recombinant human ATAD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-361 aa of BC010868

  Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD

• Full Name: ATPase family, AAA domain containing 1
• Calculated Molecular Weight: 361 aa, 41 kDa
• Observed Molecular Weight: 32-37 kDa
• GenBank Accession Number: BC010868
• Gene Symbol: ATAD1
• Gene ID (NCBI): 84896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8NBU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity.