ATF4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ATF4 Recombinant monoclonal antibody (81798-1-RR)

ATF4 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA, ChIP-qPCR

Cat No. 81798-1-RR Copied!

Clone No. 5N3

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA, ChIP-qPCR

Synonyms

cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TXREB

• 

  WB analysis of HEK-293 using 81798-1-RR

  Non-treated HEK-293 and MG132 treated HEK-293 cells were subjected to SDS PAGE followed by western blot with 81798-1-RR (ATF4 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. The membrane was stripped and re-blotted with GAPDH antibody as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 81798-1-RR

  A431 cells were subjected to SDS PAGE followed by western blot with 81798-1-RR (ATF4 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 81798-1-RR

  Non-treated HeLa and MG132 treated HeLa cells were subjected to SDS PAGE followed by western blot with 81798-1-RR (ATF4 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. The membrane was stripped and re-blotted with GAPDH antibody as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 81798-1-RR

  IP result of anti-ATF4 (IP:81798-1-RR, 4ug; Detection:81798-1-RR 1:4000) with HEK-293 cells lysate 1440 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 81798-1-RR

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 81798-1-RR (ATF4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 81798-1-RR

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 81798-1-RR (ATF4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 81798-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 81798-1-RR (ATF4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 81798-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 81798-1-RR (ATF4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 81798-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 81798-1-RR (ATF4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  ChIP experiment of NIH/3T3 using 81798-1-RR

  Chromatin was prepared from NIH/3T3 cells treated with Tunicamycin (2ug/mll) overnight. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of ATF4 (81798-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81798-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81798-1-RR against Human ATF4 were performed. The affinity constant is 0.500 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATF4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, MG132 treated HEK-293 cells, MG132 treated HeLa cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human breast cancer tissue, human stomach cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive ChIP-qPCR detected in: Tunicamycin (2ug/mll) overnight NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• CHIP-QPCR: CHIP-QPCR : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81798-1-RR targets ATF4 in WB, IHC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1279

  Product name: Recombinant human ATF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC022088

  Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

• Full Name: activating transcription factor 4 (tax-responsive enhancer element B67)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC022088
• Gene Symbol: ATF4
• Gene ID (NCBI): 468
• RRID: AB_2935580
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18848
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation[PMID: 19016586]. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies[PMID: 19726872]. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia[PMID: 18163433]. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. Endogenous ATF4 protein has a molecular mass of 50kd. [PMID: 17726049]. ATF4 can bind DNA as a homodimer and as a heterodimer. ATF4 is ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4, so the molecular weight of ATF4 may be 70 kDa.

Publications

What published studies show

The ATF4 Recombinant monoclonal antibody (5N3), catalog number 81798-1-RR, has 5 total citations. These appear in Genes Dev, Mol Med Rep, Cancers (Basel), Oncol Rep, and Endocrine. The associated research fields include stress granule biology and mRNA localization, endoplasmic reticulum stress–induced apoptosis in pancreatic cancer, mechanical stress–mediated apoptosis in glioma, colorectal cancer cell proliferation and invasion, and thyroid cancer progression with tumor microenvironment interactions.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Genes Dev; Ribosome association inhibits stress-induced gene mRNA localization to stress granules; Authors - Noah S Helton
human	WB	Mol Med Rep; Astragaloside IV promotes the apoptosis of pancreatic cancer cells by activating endoplasmic reticulum stress through the PERK/ATF4/CHOP signaling pathway.; Authors - Yijun Wang
human	WB,IHC	Cancers (Basel); Piezo1-ATF3-PPP1r15a Axis Transduces Mechanical Stress into Apoptosis in Glioma Under Low-Intensity Focused Ultrasound.; Authors - Mingming Li
human	WB	Oncol Rep; LRRC59 inhibits perk pathway‑induced apoptosis and promotes cell proliferation, migration and invasion in colorectal cancer cells.; Authors - Xingdong Hou
		Endocrine; ATF4 and FGFR4 cooperatively support thyroid cancer progression and CAF-associated tumor-promoting features.; Authors - Jinsong Zhang