ATG12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATG12 Polyclonal antibody (30505-1-AP)

• Featured Product
• KD/KO Validated

ATG12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30505-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

APG12, APG12 like, APG12L, APG12-like, Autophagy-related protein 12

• 

  WB analysis using 30505-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30505-1-AP (ATG12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30505-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30505-1-AP (ATG12 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 30505-1-AP

  WB result of ATG12 antibody (30505-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATG12 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 30505-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30505-1-AP (ATG12 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 30505-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using ATG12 antibody (30505-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATG12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells, NIH/3T3 cells, PC-3 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30505-1-AP targets ATG12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32268

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 48-187 aa of BC012266

  Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 20 kDa, 50-60 kDa
• GenBank Accession Number: BC012266
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• RRID: AB_3086340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.

Publications

What published studies show

The ATG12 Polyclonal antibody (Cat# 30505-1-AP) has 1 total citation. It appears in International Immunopharmacology (2025), where it was used in Western blot with mouse samples. The associated research investigates the BPIFA2–LRP5 axis and its role in orchestrating mitochondrial dysfunction to mediate kidney injury in lupus nephritis, placing the work within the fields of autoimmune disease, renal pathology, and mitochondrial biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int Immunopharmacol; The BPIFA2 - LRP5 axis orchestrates mitochondrial dysfunction to mediate kidney injury in lupus nephritis; Authors - Yunhe Liu