ATG12 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84935-6-RR (same clone as 84935-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84935-6-RR (ATG12 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84935-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84935-6-RR (same clone as 84935-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84935-6-RR (ATG12 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84935-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84935-6-RR (same clone as 84935-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84935-6-RR (ATG12 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84935-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84935-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84935-6-RR against Human ATG12 were performed. The affinity constant is 0.637 nM.

ATG12 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84935-6-PBS

Clone No.242483F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

242483F1, APG12, APG12 like, APG12L, APG12-like

---

Product Information

84935-6-PBS targets ATG12 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1791

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC012266

  Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC012266
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94817
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.