ATG13 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82718-3-RR (same clone as 82718-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82718-3-RR (KIAA0652 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82718-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 82718-3-RR (same clone as 82718-3-PBS)

  WB result of ATG13 antibody (82718-3-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATG13 transfected HEK-293 cells. This data was developed using the same antibody clone with 82718-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 82718-3-RR (same clone as 82718-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 82718-3-RR (ATG13 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82718-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82718-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82718-3-RR against Human ATG13 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

ATG13 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82718-3-PBS

Clone No.3G14

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA0652, 3G14, Autophagy related protein 13, Autophagy-related protein 13

---

Product Information

82718-3-PBS targets ATG13 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13090

  Product name: Recombinant human KIAA0652 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-481 aa of BC001331

  Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ*

• Full Name: KIAA0652
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC001331
• Gene Symbol: ATG13
• Gene ID (NCBI): 9776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75143
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405)