ATG2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATG2B Polyclonal antibody (25155-1-AP)

• Featured Product
• KD/KO Validated

ATG2B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25155-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

Autophagy-related protein 2 homolog B, C14orf103

• 

  WB analysis using 25155-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25155-1-AP (ATG2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 25155-1-AP (ATG2B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 25155-1-AP (ATG2B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 25155-1-AP (ATG2B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 25155-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ATG2B antibody (25155-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATG2B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, A549 cells
• Positive IHC detected in: human pancreas cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25155-1-AP targets ATG2B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18412

  Product name: Recombinant human ATG2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1304-1555 aa of BC015016

  Sequence: RDYVRVMDMGLLELTITAVKSDSDGEQTEPRFELHCSSDVVHIRTCSDSCAALMNLIQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVS

• Full Name: ATG2 autophagy related 2 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 2078 aa, 233 kDa
• Observed Molecular Weight: 240-250 kDa
• GenBank Accession Number: BC015016
• Gene Symbol: ATG2B
• Gene ID (NCBI): 55102
• RRID: AB_2810874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The antibody targeting ATG2B (Cat# 25155-1-AP) has 22 citations across journals including Nature, Nature Communications, Nature Cell Biology, Autophagy, Molecular Cell, Cell Reports, EMBO Reports, FASEB Journal, Theranostics, Metabolism, Human Molecular Genetics, and others. Research fields span autophagy mechanisms, lysosomal repair, lipid droplet biology, plasma membrane integrity, cancer (ovarian, colorectal, renal, myeloma), neurodegeneration, viral replication, and extracellular vesicle secretion. Applications are predominantly WB and IF.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A phosphoinositide signalling pathway mediates rapid lysosomal repair; Authors - Jay Xiaojun Tan
human	WB	Nat Cell Biol; ATG9A protects the plasma membrane from programmed and incidental permeabilization.; Authors - Aurore Claude-Taupin ; KO Validated
human	WB	Autophagy; Architecture of the ATG2B-WDR45 complex and an aromatic Y/HF motif crucial for complex formation.; Authors - Jing-Xiang Zheng
human	WB	Autophagy; SHISA5/SCOTIN restrains spontaneous autophagy induction by blocking contact between the ERES and phagophores.; Authors - Jee-Eun Lee
human	WB	Nat Commun; Autophagy-independent role of ATG9A vesicles as carriers for galectin-9 secretion; Authors - Wenting Zhang
human	IF	Nat Commun; The autophagy protein ATG9A enables lipid mobilization from lipid droplets.; Authors - Elodie Mailler ; KO Validated