ATG4B Monoclonal antibody, PBS Only

• 

  WB analysis using 67727-1-Ig (same clone as 67727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67727-1-Ig (ATG4B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67727-1-Ig (same clone as 67727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67727-1-Ig (ATG4B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HuH-7 using 67727-1-Ig (same clone as 67727-1-PBS)

  WB result of ATG4B antibody (67727-1-Ig; 1:800; room temperature for 1.5 hours) with wild-type and ATG4B knockout HuH-7 cells. This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67727-1-Ig (same clone as 67727-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67727-1-Ig (ATG4B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 67727-1-Ig (same clone as 67727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67727-1-Ig (ATG4B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 67727-1-Ig (same clone as 67727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67727-1-Ig (ATG4B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 67727-1-Ig (same clone as 67727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67727-1-Ig (ATG4B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67727-1-Ig (same clone as 67727-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ATG4B antibody (67727-1-Ig, Clone: 1G5A7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67727-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ATG4B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67727-1-PBS

Clone No.1G5A7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Autophagy-related cysteine endopeptidase 1, Autophagin-1, AUT-like 1 cysteine endopeptidase, AUTL1, APG4B

---

Product Information

67727-1-PBS targets ATG4B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30510

  Product name: Recombinant human ATG4B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-393 aa of BC000719

  Sequence: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

• Full Name: ATG4 autophagy related 4 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC000719
• Gene Symbol: ATG4B
• Gene ID (NCBI): 23192
• RRID: AB_2882913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y4P1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATG4B(autophagy 4) is also named as APG4B, AUTL1, KIAA0943 and belongs to the peptidase C54 family. It is a homolog of yeast Apg4, a cysteine protease involved in autophagy and is a cytoplasmic enzyme. This protein is highly expressed in skeletal muscle, with lower expression in heart, liver, and pancreas and no expression is detected in fetal tissues by the northern blot. ATG4B is widely expressed in tumor cell lines (PMID:12446702). It has some isoforms produced by alternative splicing with molecular mass of 31-52 kDa.