GABARAPL1 Recombinant monoclonal antibody, PBS Only

GABARAPL1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 83817-1-PBS
Clone No.240533F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

240533F5, APG8 LIKE, APG8L, ATG8, ATG8L

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83817-1-PBS targets GABARAPL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1473

Product name: Recombinant human ATG8L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-117 aa of BC009309

Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Predict reactive species
Full Name GABA(A) receptor-associated protein like 1
Calculated Molecular Weight 14 kDa
Observed Molecular Weight16 kDa
GenBank Accession NumberBC009309
Gene Symbol GABARAPL1
Gene ID (NCBI) 23710
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9H0R8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2 and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle and at very low levels in the thymus and small intestine.

Loading...
||
New chat Able
正在加载,请稍候...